DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and pnliprp2

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:330 Identity:96/330 - (29%)
Similarity:145/330 - (43%) Gaps:52/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVK 127
            :|.:......:|:||.::..|..:|:.......:..|.|.|..:||.:|||::.......:..:.
 Frog    45 LPDSPEHINTRFLLFTKENPDTFQEIRALTPGAISTSNFKASRKTRFIIHGFIEHGYDRWLTHMC 109

  Fly   128 NAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMH 192
            ...|.:            ||.|....||:..:..: |.:.|..|..:||.:|..:::|:.:....
 Frog   110 ATLLKV------------EDVNCFCVDWTGGAYAL-YSQAANNVRVVGAEVAHFIQFLSNQYGYS 161

  Fly   193 YDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSV 257
            ..:|:|||||||:..||..||:..  ....|..||||||.|:....|.|:|.|||..|:.|.|..
 Frog   162 AANVHVIGHSLGSHAAGETGKRTP--GIARITGLDPAGPFFQNTPPEVRLDQSDAQLVDVIHTDA 224

  Fly   258 S-------FGFEQPVGHATFYPNYGKNQKKC-------------------YVYGCSHKRSHDYFI 296
            |       ||..|.|||..||||.|||...|                   .:..|||.||:.::.
 Frog   225 SAIFPLTGFGIGQSVGHLDFYPNGGKNMPGCKKSPTLKYLDNYRIFKGSKEIIFCSHIRSYKFYT 289

  Fly   297 ESLTSPAGFWG-PRCE--RHDDGTWLLLMSDGEFRMG--GEPSI-PKNG--TFYVKTYSKPPYAM 353
            ||:.:|..|.. |..:  ....||.....|.|...||  .|..: |.:|  :|::.|.:..|:| 
 Frog   290 ESILTPDAFVAFPSSDYKTFKKGTGFPCPSGGCPLMGHYAEEFLGPTSGNLSFFLNTGNSEPFA- 353

  Fly   354 GHRWQ 358
              ||:
 Frog   354 --RWR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 92/320 (29%)
Pancreat_lipase_like 71..347 CDD:238363 91/309 (29%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 92/321 (29%)
PLAT 355..466 CDD:320707 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.