DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:282 Identity:82/282 - (29%)
Similarity:135/282 - (47%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LIPFTSSRGKMQFILFKRDFADCGRELFVG-DVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRK 125
            |:|::......:|:|:..:..: ..:|..| :.:.:..|.|....:||.:|||::.:::.|....
Human    44 LLPWSPEDIDTRFLLYTNENPN-NFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSD 107

  Fly   126 VKNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEAN 190
            :......:            |..|.|..|| :..:...|.:..:.:..:||..|.|::.|:.:..
Human   108 MCKKMFEV------------EKVNCICVDW-RHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLG 159

  Fly   191 MHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT 255
            ...:||:||||||||..|..||:: :..|...|..||||||.|:::.:|.|:|.|||.:|:.|.|
Human   160 YSLEDVHVIGHSLGAHTAAEAGRR-LGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHT 223

  Fly   256 -------SVSFGFEQPVGHATFYPNYGKNQKKC--------------------YVYGCSHKRSHD 293
                   |:.||..|.|||..|:||.||....|                    :| .|:|.||.:
Human   224 DSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFV-SCNHLRSFE 287

  Fly   294 YFIESLTSPAGFWGPRCERHDD 315
            |:..|:.:|.||.|..|..:|:
Human   288 YYSSSVLNPDGFLGYPCASYDE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 81/280 (29%)
Pancreat_lipase_like 71..347 CDD:238363 80/273 (29%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 82/282 (29%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 4/11 (36%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 1/22 (5%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.