DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and liph

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis


Alignment Length:348 Identity:91/348 - (26%)
Similarity:142/348 - (40%) Gaps:101/348 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTR---IVIHGWMSQSKGSHIRKVKNAYLS 132
            |:|.:|:.|:...|.::|   :|:|  ::||...:.||   .:.||:.                 
 Frog    46 KVQLLLYTRENPKCAQDL---NVDN--STGFQYLNVTRRTVFITHGYR----------------- 88

  Fly   133 LTDPGPNGEPAPY-----------EDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELV-RYL 185
                 |.|.|..:           :||||||.||::.:|.|.|:..|.....:..:|...: ..|
 Frog    89 -----PTGSPPVWIDDIVKKFLDIQDFNVIVVDWNRGATTVLYHNAAANTRKVADILKRFIDNML 148

  Fly   186 NQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYR--FNTIYALDPAGPQFREKSDEYRIDASDAS 248
            :|.|.:  |.:|::|.||||.|:|..||.   |.  ...|..||||||.|..|..|.|:..:||.
 Frog   149 SQGATL--DSIYMVGVSLGAHISGFVGKM---YNGSIGRITGLDPAGPLFNGKPPEERLHYTDAQ 208

  Fly   249 YVESIQTSV-SFGFEQPVGHATFYPNYGKNQKKC--------YVYGCSHKRSHDYFIESLTSPAG 304
            :|:.:.:.. ..|:::.:||..||||.|.:|..|        ..:.|.|:||...:|.|||....
 Frog   209 FVDVVHSDTDGLGYKESLGHIDFYPNGGTDQPGCPKTILAGSEYFKCDHQRSVFLYIASLTKSCD 273

  Fly   305 FWGPRCERHDDGTWLLLMSDGEFRMGG--------EPSIPKNG------------------TFYV 343
            .....|:.:.|           :|:|.        ..|.|..|                  |.:.
 Frog   274 LVAFPCKSYRD-----------YRIGNCTDCKEFLPLSCPVLGFYADKWKDHLVKRNHPGTTAFF 327

  Fly   344 KTYSKPPYAMGH------RWQTE 360
            .|.:|.||.:.|      .|.::
 Frog   328 DTAAKDPYCIFHYYLDFMTWSSQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 87/331 (26%)
Pancreat_lipase_like 71..347 CDD:238363 86/327 (26%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 84/308 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.