DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG17191

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:354 Identity:116/354 - (32%)
Similarity:178/354 - (50%) Gaps:39/354 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGVDPSF-W--KKFFKHLIPFTS----SRGK 71
            |.:|.||::...|:...|...|....:.:.:     :|.|| |  |:..:.|:...|    ....
  Fly     3 VFIALAALLATVSALPIEERVNGENGWYVPQ-----IDGSFEWMDKQDAEELLNRNSLIETRSND 62

  Fly    72 MQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQ-SKGSHIRKVKNAYLSLTD 135
            :.|.|:.:.....|:|: ..|..::.:|.||....||.|||||..: :.|.:: |:..|:||   
  Fly    63 VSFYLYTKHNPTVGKEI-RADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNV-KITRAWLS--- 122

  Fly   136 PGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIG 200
               .|      |:||||.:|.: :.:|:|....:.|...||.:.|::.||::..::..:.:.|||
  Fly   123 ---KG------DYNVIVVNWDR-AQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIG 177

  Fly   201 HSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTS-VSFGFEQP 264
            |||||.:||.||||:...|.:||..||||.|.|.....:.|:...||.|||||||: ...||.:|
  Fly   178 HSLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKP 242

  Fly   265 VGHATFYPNYGKNQKKC--YVYG-CSHKRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMSDGE 326
            :|..|||||.|:||..|  .:.| |:|.||..|::|::|.. .|...:|  ||....|.......
  Fly   243 IGKGTFYPNGGRNQPGCGSDIGGTCAHGRSVTYYVEAVTED-NFGTIKC--HDYQAALANECGST 304

  Fly   327 F---RMGG-EPSIPKNGTFYVKTYSKPPY 351
            :   |||. ..:...:|.|||....:.|:
  Fly   305 YSGVRMGAVTNAYMVDGDFYVPVNGQAPF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 102/299 (34%)
Pancreat_lipase_like 71..347 CDD:238363 101/284 (36%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 101/283 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.