DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG6295

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:273 Identity:95/273 - (34%)
Similarity:139/273 - (50%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NLRNSGFDARHQTRIVIHGWMSQSKGSHIR-KVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKT 158
            ::..|.|:..|.||..|||| |.||...|. .|::|:.:            :.|.|:|..||.: 
  Fly    86 SISGSHFNPNHPTRFTIHGW-SSSKDEFINYGVRDAWFT------------HGDMNMIAVDWGR- 136

  Fly   159 STNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTI 223
            :.:|:|......|..:|..:|.|:.::.....::.|:..||||||||.::|.|||.:...:.:||
  Fly   137 ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTI 201

  Fly   224 YALDPAGPQFREKSDEYRIDASDASYVESIQTS-VSFGFEQPVGHATFYPNYGKNQKKCYV---Y 284
            ..||||.|.|...|...|:.::||.|||||||: .:.||.:|:|...||||.||:|..|.|   .
  Fly   202 IGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQPGCGVDLTG 266

  Fly   285 GCSHKRSHDYFIESLTSPAGFWGPRCERHDD------GTWLLLMSDGEFRMGGEP-SIPKNGTFY 342
            .|:|.||..|:.||:|. ..|...||..:::      |:     |....|||... :....|.:|
  Fly   267 SCAHSRSVIYYAESVTE-NNFPTMRCGDYEEAVAKECGS-----SYSSVRMGATTNAYMVAGDYY 325

  Fly   343 VKTYSKPPYAMGH 355
            |...|..||.||:
  Fly   326 VPVRSDAPYGMGN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 91/267 (34%)
Pancreat_lipase_like 71..347 CDD:238363 90/263 (34%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 90/263 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.