DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and lipca

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:314 Identity:88/314 - (28%)
Similarity:129/314 - (41%) Gaps:62/314 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CGRELFVGDVENLRNSGFDARHQTRIVIHGW-MSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYED 147
            |..|||  ....|...||::.....|:|||| :.......|.::.:|..|...           :
Zfish    59 CALELF--QPHTLDACGFNSSLPLAIIIHGWSVDGMMEKWISRLASALKSSEG-----------N 110

  Fly   148 FNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAG 212
            .||::.|| .|..:.:|...|:....:|..:|.|:.:|..........|::||:||||.|:|.||
Zfish   111 INVLIADW-LTLAHQHYPIAAQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIGYSLGAHISGFAG 174

  Fly   213 KQI-MPYR-FNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT------SVSFGFEQPVGHAT 269
            ..: |..| ...|..||||||.|...|...|:...||.:|::|.|      .:|.|.:|||.|..
Zfish   175 SNLAMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQPVAHFD 239

  Fly   270 FYPNYGKNQKKCYVY--------------------GCSHKRSHDYFIES-LTSPAGFWGPRCERH 313
            ||||.|..|..|.::                    .|:|:|:...||:| |.........:|..:
Zfish   240 FYPNGGSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDN 304

  Fly   314 ---DDGTWL---------LLMSDGEFRMGGEPSIPKNGTFYVKTYSKPPYAMGH 355
               |.|..|         |.....:.|.|      |:...::||.|..||.:.|
Zfish   305 TAFDKGNCLDCRKNRCNTLGYDIKKVRTG------KSKRLFLKTRSHMPYKLFH 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 85/308 (28%)
Pancreat_lipase_like 71..347 CDD:238363 84/304 (28%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 88/314 (28%)
Pancreat_lipase_like 54..344 CDD:238363 84/304 (28%)
PLAT_LPL 351..485 CDD:238856 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.