DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG13562

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:392 Identity:75/392 - (19%)
Similarity:134/392 - (34%) Gaps:108/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIMSAVLLAFAAIVFASSSEKTELD---------PNATCNYTLVKKKTLGVDPSFWKKFFKHLIP 64
            |...::|:....::...:..|..|.         ..||.|.||..::.:..|             
  Fly     5 SSFHSILIVCCVLLIDGTHSKLNLKYAILRQKQAAKATQNDTLAHQQRIKYD------------- 56

  Fly    65 FTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNA 129
               ::..|:.:.:|.:........: .|..:|..||.....:..||:|||:........      
  Fly    57 ---AQKTMKVMFYKNNTKTMETSAY-DDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWA------ 111

  Fly   130 YLSLTDPGPNGEPAPYEDFNVIVC-DWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHY 193
             |||.      |...|.....::| |:|..::: :|..:....:.:...::.::..|.::.   :
  Fly   112 -LSLI------ERLSYYRGGCVICIDYSVVASS-SYMRLYTNFDTLTGAISSIILTLFRQG---F 165

  Fly   194 DDV--YVIGHSLGAQIAGSAGKQIMPYR-FNTIYALDPAGPQFREKSDEYRIDASDA-SYVESIQ 254
            |..  |:.|.|.|.|:|.:.|:.:.|:. ..:|...|.|||.|    |...:|.|.| .:|:...
  Fly   166 DPKRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGF----DPIAVDHSKAGKHVQCFH 226

  Fly   255 TSVSFGFEQPVGHATFYPNYGKNQKKCYVYGCS-------------------HKRSH----DYFI 296
            :|                    ..|..:||.|.                   |..||    |.:|
  Fly   227 SS--------------------RDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYI 271

  Fly   297 ESLTSP---AGFWGPRCERHDDGTW--LLLMSDGEFRMGGEPSIPK--NGTFYVKTYSKPPYAMG 354
            .:...|   ..:..|.|     .||  ...:.|| :.:|.|.:...  .|..:|.|....||.:.
  Fly   272 NTFDYPFYAVNYTPPEC-----FTWQKTAKIPDG-YTVGYEENFDSQVTGQIFVPTSLHYPYNLS 330

  Fly   355 HR 356
            .:
  Fly   331 KK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 63/321 (20%)
Pancreat_lipase_like 71..347 CDD:238363 63/310 (20%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 34/161 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.