DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG6472

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:371 Identity:109/371 - (29%)
Similarity:164/371 - (44%) Gaps:83/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGVDPSFWKKFFKHLIPFTSSRGKMQFILFKR 79
            |||.:.|.::::       |..:|:.....|:                      |..::|:|:..
  Fly    16 LLAGSPIFYSAA-------PRGSCSTCCAIKE----------------------REDIKFMLYTS 51

  Fly    80 DFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSH--IRKVKNAYLSLTDPGPNGEP 142
            ...:..:.|.:.|...|..|.|:..:...|.:||:...:.|..  .:::|:|:|.      .|  
  Fly    52 RNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLR------RG-- 108

  Fly   143 APYEDFNVIVCDWSKTSTNVNYYEVAKTVEDM---GALLAELVRYLNQEANMHYDDVYV--IGHS 202
                ::|||:.||| ..|.|.:|  :..||::   |..||..:|:|   .:..|...|:  ||.|
  Fly   109 ----NYNVILIDWS-AMTAVPWY--SNAVENLPVSGRYLARFLRFL---VDKGYPAKYIHLIGFS 163

  Fly   203 LGAQIAGSAGKQIMPY--RFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSVS-FGFEQP 264
            |||::||.||||:..:  :...|.|||||.|.|...|...|:..|||.:|:.|.|... .|...|
  Fly   164 LGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAP 228

  Fly   265 VGHATFYPNYGKN-QKKC-----------YVYGCSHKRSHDYFIESLTSPAGFWGPRCERHD--- 314
            :|||.||||.|:. |..|           .:.||||:|:.:||:||:..|.||...|||..|   
  Fly   229 MGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFG 293

  Fly   315 ----DGTWLLLMSDGEFRMGGEPSIPKNGTFYVKTYSKPPYAMGHR 356
                .|.....|.     ||.:|.|  .|.||:.|....|:....|
  Fly   294 ICREPGGGPAFMG-----MGADPRI--RGKFYLDTNDAKPFGRNSR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 100/315 (32%)
Pancreat_lipase_like 71..347 CDD:238363 99/304 (33%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 99/304 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.