DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG13282

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:281 Identity:91/281 - (32%)
Similarity:134/281 - (47%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTS 159
            ||.:|.|:.|:.|:|:|||:.|......:::::..||:..            |:|:|..|||..|
  Fly   103 NLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLAKA------------DYNIIYVDWSILS 155

  Fly   160 TNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIY 224
            ....|.......:..|...|:||..|.:..|   .|::|||.|||||:.....:.:..:....|.
  Fly   156 PGPCYISAVHNTKHAGTCTAQLVERLVETGN---TDIHVIGFSLGAQVPNYIARNLSSFMLPRIT 217

  Fly   225 ALDPAGPQFREKSDEYRIDASDASYVESIQTSVSF-GFEQPVGHATFYPN-----YGKNQKKCYV 283
            .||||.|.|.......::|.||||||:.|.|:... |..:..|||.||.|     .|.|.:|...
  Fly   218 GLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADFYMNGGIMQPGCNGQKINS 282

  Fly   284 YGCSHKRSHDYFIESLTSPAGFWGPRCERHDDGTWLL--------LMSDGEFRMGGEPSIPKNGT 340
            :.|||:|:..||:||:.||.||||..|..:.  ::||        |:..||   ...|:  ..|.
  Fly   283 FACSHQRAPAYFLESIRSPKGFWGWACSGYI--SYLLGMCPPTNFLLEAGE---NIRPT--TRGM 340

  Fly   341 FYVKTYSKPPYAMGHRWQTEP 361
            |.:.|....|:|:| :|...|
  Fly   341 FMIDTNDSSPFALG-KWTDLP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 86/269 (32%)
Pancreat_lipase_like 71..347 CDD:238363 86/265 (32%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 86/269 (32%)
Pancreat_lipase_like 75..347 CDD:238363 86/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.