DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG18641

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:324 Identity:91/324 - (28%)
Similarity:140/324 - (43%) Gaps:65/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKN 128
            |:.....|:||.|:.|...:....:.|.|...|..:.|:.||.|:|:|||:......|....::.
  Fly    62 PYRCPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLRE 126

  Fly   129 AYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVED-----------MGAL-LAEL 181
            ||.|:      ||      :|:|:.|:            |..|::           .|:| :::|
  Fly   127 AYFSV------GE------YNIIIVDY------------ADAVKEPCLSQMDWAPRFGSLCISQL 167

  Fly   182 VRYL-NQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPY--RFNTIYALDPAGPQFREKSDEYRID 243
            |:|| .....:..||::.||:|:||.|||.....:.|.  :...|.||||....:...::...:|
  Fly   168 VKYLARHPRGVQPDDLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLD 232

  Fly   244 ASDASYVESIQTSVS-FGFEQPVGHATFYPNYGKNQKKC-------YVYGCSHKRSHDYFIESLT 300
            ::||.:|:.:.|... .|.....|||.||.|.|..|..|       ....|.|.:...|||||:|
  Fly   233 STDAHFVDVLHTGAGILGQWHSSGHADFYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESIT 297

  Fly   301 SPAGFWGPRCERHDDGTWLLLMS---------DGEFRMGGEPSIPK-NGTFYVKTYSKPPYAMG 354
            :..||:...|..        |.|         |.|:.:.||....| .|.:||.|.:|.|:|.|
  Fly   298 TTRGFYAGPCPN--------LFSYLIGWCEPKDSEYVLMGEHCSHKARGNYYVTTNAKAPFARG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 88/319 (28%)
Pancreat_lipase_like 71..347 CDD:238363 86/308 (28%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 86/309 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.