DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG6847

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster


Alignment Length:312 Identity:86/312 - (27%)
Similarity:135/312 - (43%) Gaps:62/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCD 154
            :.|:|     ||| ....|:::||:.|......|.::|.|.:::            ||..||..|
  Fly   181 IDDLE-----GFD-ELSVRVIVHGFGSACPHVWIYEMKTALMAV------------EDCIVICVD 227

  Fly   155 WSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYR 219
            |...:|..||...|.....:|..||.|:|.|.|...:.....:|||.||||.::|.||.::.  .
  Fly   228 WENGATFPNYVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELP--G 290

  Fly   220 FNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTS------VSFGFEQPVGHATFYPNYGKNQ 278
            .:.|..||||||.|..:..:.|:|:|||.:|:.|.::      ...|..||:||..:|||.|:.|
  Fly   291 LSRITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQ 355

  Fly   279 KKC----------YVYG------------CSHKRSHDYFIESLTSPAGFWGPRCERHDD---GTW 318
            ..|          :::.            |:|:|::.:||:|:.....|....|..:||   |..
  Fly   356 TGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRC 420

  Fly   319 LLLMSDGEFRMGGEPSIPK----------NGTFYVKTYSKPPYAMGHRWQTE 360
            .....|.|....|.|....          .|..|:.|..:.|:. .|::|.:
  Fly   421 FPCAQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLTREEEPFC-AHQFQLQ 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 83/301 (28%)
Pancreat_lipase_like 71..347 CDD:238363 83/297 (28%)
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 83/301 (28%)
Pancreat_lipase_like 185..459 CDD:238363 82/293 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.