DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and CG5162

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:371 Identity:93/371 - (25%)
Similarity:146/371 - (39%) Gaps:88/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAVLLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGVDPSFWKKFFKHLIPFTSSRGKMQFIL 76
            |..|:|.....|.|:|      .|..|:..|...|...              .::....||.|.|
  Fly    60 SKQLIAGYPFEFVSNS------LNVICSQALASNKIKS--------------KYSPDINKMNFQL 104

  Fly    77 FKRDFADCGRELF-VGDVENLRNSG-FDARHQTRIVIHGWMSQSKGSH-IRKVKNAYLSLTDPGP 138
                ...|.::.| :...|::..|. ||.:.:..|:..||.:...||. |.....||      ..
  Fly   105 ----QTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAY------NC 159

  Fly   139 NGEPAPYEDFNVIVCD----------WSKTSTNVNYYEVAKTVEDMGALLA-ELVRYLNQEANMH 192
            .|      |.|.:..|          ||..:|           |::|..:| .||:.|:.   :.
  Fly   160 RG------DVNFVAVDAARFVDTLYTWSAFNT-----------EEIGENIALGLVKLLDL---VP 204

  Fly   193 YDDVYVIGHSLGAQIAGSAGKQIMPYRFNT---IYALDPAGPQFREKSDEYRIDASDASYVESIQ 254
            .:::::|||||||.|.||||:.:......|   |..||||.|.|.|......:...||.:|:.|.
  Fly   205 VENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIH 269

  Fly   255 TSVS-FGFEQPVGHATFYPNYGKN--QKKCYVYGCSHKRSHDYFIESL--TSPAGFWGPRCERHD 314
            ::.. .|...|||...|||. |.:  ...|:...|:|.||.:||.|::  .:...|...||..  
  Fly   270 SNPGVLGKRDPVGDVDFYPG-GMSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMATRCNS-- 331

  Fly   315 DGTWLLLMSDGEFRMGGEP-----SIPKN--GTFYVKTYSKPPYAM 353
                  :....:||..|:.     ::|:|  |.::::..:..|:.|
  Fly   332 ------ISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFGM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 81/315 (26%)
Pancreat_lipase_like 71..347 CDD:238363 81/304 (27%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 81/313 (26%)
Pancreat_lipase_like 99..365 CDD:238363 81/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.