DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Yp1

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:258 Identity:63/258 - (24%)
Similarity:108/258 - (41%) Gaps:67/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCD-WSKTST 160
            :|...|.:.|:........:.|:..:..:||||   .|..|           ::||.| .||.:|
  Fly   165 KNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNA---KTQSG-----------DIIVIDLGSKLNT 215

  Fly   161 NVNY--YEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQ---IMPYRF 220
            ...|  .::.||...:|..:.::|    .|.:|.:|.:::||.::||.:||:|.::   :..::.
  Fly   216 YERYAMLDIEKTGAKIGKWIVQMV----NELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKL 276

  Fly   221 NTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSVSFGFEQPV--GHATFYPNYGKNQKKCYV 283
            ..:..|||:....:.|:....:...||.:|::|.||| :|...|:  |...|||    |.....|
  Fly   277 RRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV-YGMGTPIRSGDVDFYP----NGPAAGV 336

  Fly   284 YGCSH-----KRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMSDGEFRMGGE---PSIPKN 338
            .|.|:     .|:..||.||:                            |.|.|   |::|.|
  Fly   337 PGASNVVEAAMRATRYFAESV----------------------------RPGNERSFPAVPAN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 63/258 (24%)
Pancreat_lipase_like 71..347 CDD:238363 63/258 (24%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 60/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.