DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Yp2

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:232 Identity:53/232 - (22%)
Similarity:92/232 - (39%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSL 203
            |||....:..::||........:...| ....:|.:|.::...:..|....|:..:.:::||...
  Fly   194 NGEQDDTKTGDLIVIQLGNAIEDFEQY-ATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGP 257

  Fly   204 GAQIAGSAGKQI---MPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSV-SFGFEQP 264
            .|.:||.||:|.   ..::...|.||||.....:.:.....:...||.:|::|.||. ..|..|.
  Fly   258 AAHVAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQR 322

  Fly   265 VGHATFYPNYGKNQKKCYVYGCSH-----KRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMSD 324
            :.:..|:|| |.:..   |.|..:     .|:..||.||:.       |..||:...  :...|.
  Fly   323 LANVDFFPN-GPSTG---VPGADNVVEATMRATRYFAESVR-------PGNERNFPS--VAASSY 374

  Fly   325 GEFR----------MGGEPSIPKNGTFYVKTYSKPPY 351
            .|::          ||........|.:.::..||.|:
  Fly   375 QEYKQNKGYGKRGYMGIATDFDLQGDYILQVNSKSPF 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 52/230 (23%)
Pancreat_lipase_like 71..347 CDD:238363 50/226 (22%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 52/230 (23%)
Abhydrolase <221..407 CDD:304388 44/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.