DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and lpl

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:402 Identity:106/402 - (26%)
Similarity:169/402 - (42%) Gaps:88/402 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MISQLGRISIMSAVLLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGVDPSFWKKFFKHLIPF 65
            |:...||:|  ||.|:::...|:.||..:|.:||.|.   ::.....:| :.:.|      ::.|
Zfish     1 MMFNKGRVS--SAFLISWMYFVYISSGLETTIDPTAE---SITLSDIIG-NATEW------MMDF 53

  Fly    66 TSSRGKMQFILFKRDFAD-CGRELFVGDVENLRNSGFDARHQTRIVIHGW-MSQSKGSHIRKVKN 128
            |....|..|...:....| |  .:..|..:::::..|:...:|.|||||| ::....|.:.|:..
Zfish    54 TDIESKFSFRTLEEPEDDLC--YIVPGQPQSIKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVT 116

  Fly   129 AYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHY 193
            |..       ..||:.    ||||.||...:.. :|...|...:.:|..:|:.|.:|..|.:..:
Zfish   117 ALY-------EREPSA----NVIVVDWLSRAQQ-HYPTSASYTKLVGKDVAKFVNWLQAEIDYPW 169

  Fly   194 DDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSV- 257
            :.::::|:||||.:||.|| .:..::.|.|..:|||||.|........:...||::|:.:.|:. 
Zfish   170 EKLHLLGYSLGAHVAGIAG-LLTKHKVNRITGMDPAGPTFEYADSLSTLSPDDANFVDVLHTNTR 233

  Fly   258 -----SFGFEQPVGHATFYPNYGKNQKKC------------------YVYGCSHKRSHDYFIESL 299
                 |.|.::||||...|||.|..|..|                  .:..|||:||...||:||
Zfish   234 GSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSL 298

  Fly   300 TS----PAGFWGPRCERHDDGTWLLLMSDGEFRMGGEPSIPKN-----------------GTFYV 343
            .:    ...|   ||...|           .|..|...|..||                 ...|:
Zfish   299 VNQDHESMAF---RCSSRD-----------SFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKMYM 349

  Fly   344 KTYSKPPYAMGH 355
            ||....||.:.|
Zfish   350 KTREMMPYKVFH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 87/333 (26%)
Pancreat_lipase_like 71..347 CDD:238363 85/322 (26%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 90/339 (27%)
Pancreat_lipase_like 56..353 CDD:238363 85/325 (26%)
PLAT 360..484 CDD:294016 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.