DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Lipg

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:310 Identity:84/310 - (27%)
Similarity:130/310 - (41%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GRELFVGDVENLRNSGFDARHQTRIVIHGW-MSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDF 148
            |..|.:||.:.|.|.||:...:|..:|||| ||....|.:.|:.:|..:..           ::.
  Rat    65 GCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMSGMFESWLHKLVSALQTRE-----------KEA 118

  Fly   149 NVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGK 213
            ||:|.||...:..: |.:.......:|..:|.::.:|.::......||::||:||||.:||.|| 
  Rat   119 NVVVVDWLPLAHQL-YIDAVSNTRVVGRRVAGMLNWLQEKGEFSLGDVHLIGYSLGAHVAGYAG- 181

  Fly   214 QIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT-----SVSFGFEQPVGHATFYPN 273
            ..:......|..||||||.|.......|:...||.:|:.:.|     .:|.|...||||...|||
  Rat   182 NFVKGTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPN 246

  Fly   274 YGKNQKKC--------YVYG-------CSHKRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMS 323
            .|..|..|        :.||       |.|:|:...|::||.:           .|..::....:
  Rat   247 GGDFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDSLVN-----------QDKPSFAFQCT 300

  Fly   324 D-GEFRMGGEPSIPK-----------------NGTFYVKTYSKPPYAMGH 355
            | ..|:.|...|..|                 |...|:||.:..|:.:.|
  Rat   301 DPNRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAGMPFRVYH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 82/304 (27%)
Pancreat_lipase_like 71..347 CDD:238363 82/300 (27%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 82/300 (27%)
lipo_lipase 53..488 CDD:132274 84/310 (27%)
Heparin-binding. /evidence=ECO:0000250 327..339 2/11 (18%)
PLAT_LPL 349..485 CDD:238856 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.