DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Pnlip

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:338 Identity:92/338 - (27%)
Similarity:151/338 - (44%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKV- 126
            :|::.::...:|:|:..:..| ..:....|..::|||.|....:|||:|||::.:.:.:.:..: 
  Rat    44 LPWSPAQINTRFLLYTNENQD-NYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMC 107

  Fly   127 KNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANM 191
            ||.:             ..|..|.|..|| |..:...|.:..:.|..:||.:|.||..|..:...
  Rat   108 KNMF-------------KVESVNCICVDW-KGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGY 158

  Fly   192 HYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT- 255
            ..|:|::||||||:.:||.|||:... ....|..||.|.|.|:...:|.|:|.:||.:|::|.| 
  Rat   159 SPDNVHLIGHSLGSHVAGEAGKRTFG-AIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTD 222

  Fly   256 ------SVSFGFEQPVGHATFYPNYGKNQKKCY-------------------VYGCSHKRSHDYF 295
                  ::.||..|.|||..|:||.|.....|.                   ...|:|.||:.|:
  Rat   223 AAPIIPNLGFGMSQTVGHLDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYY 287

  Fly   296 IESLTSPAGFWGPRCERHDDGTWLLLMSDGEFRMGGEPSIPKNG---------------TFYVKT 345
            .:|:.:|.||.|..|..::     :..::..|..|.| ..|:.|               .||:.|
  Rat   288 TDSIVNPTGFSGFSCSSYN-----VFSANKCFPCGSE-GCPQMGHYADKYPGKTKELYQKFYLNT 346

  Fly   346 YSKPPYAMGHRWQ 358
            ..|..:|   ||:
  Rat   347 GDKSNFA---RWR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 89/328 (27%)
Pancreat_lipase_like 71..347 CDD:238363 87/317 (27%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 89/329 (27%)
PLAT_PL 355..465 CDD:238857 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.