DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Lipc

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:368 Identity:99/368 - (26%)
Similarity:154/368 - (41%) Gaps:83/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGVDPSFWKKFFKHLIPFTSSRGKMQ-----FILFKRDFADCGRELFVGDVENLRNSGFDARHQT 107
            :|.:|      |...:..|..|..:|     |:|||.:....|.:|.....|.|:..||::.|..
  Rat    26 VGTEP------FGRNLGATEERKPLQKPEIRFLLFKDESDRLGCQLRPQHPETLQECGFNSSHPL 84

  Fly   108 RIVIHGWM--------------SQSKG---SHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDW 155
            .::||||.              ||..|   :.|.|:..|..|     ...:|.     ||.:.||
  Rat    85 VMIIHGWSGSESATVGKDSDNDSQVDGLLETWIWKIVGALKS-----RQSQPV-----NVGLVDW 139

  Fly   156 SKTSTNVNYYEVA-KTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYR 219
              .|....:|.:| :....:|..:|.|:.:|.:........|::||:||||.::|.||..:...|
  Rat   140 --ISLAYQHYAIAVRNTRVVGQEVAALLLWLEESMKFSRSKVHLIGYSLGAHVSGFAGSSMGGKR 202

  Fly   220 -FNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT------SVSFGFEQPVGHATFYPNYGKN 277
             ...|..||||||.|...|...|:...||::|::|.|      .:|.|.:||:.|..||||.|..
  Rat   203 KIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSF 267

  Fly   278 QKKCYV---------YG---------CSHKRSHDYFIESL----TSPAGFWGPRCERHDDGTWLL 320
            |..|:.         :|         |:|:||...||:||    ....||   :|...|..:..|
  Rat   268 QPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSNLQNTGF---QCSNMDSFSQGL 329

  Fly   321 LMSDGEFRMGG--------EPSIPKNGTFYVKTYSKPPYAMGH 355
            .::..:.|...        .|.  |:.|.::.|.::.|:.:.|
  Rat   330 CLNCKKGRCNSLGYDIRRDRPR--KSKTLFLITRAQSPFKVYH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 94/346 (27%)
Pancreat_lipase_like 71..347 CDD:238363 92/335 (27%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 97/362 (27%)
Pancreat_lipase_like 47..362 CDD:238363 91/331 (27%)
PLAT_LPL 369..504 CDD:238856 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.