DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 / 18946 MGIID:97723 Length:473 Species:Mus musculus


Alignment Length:282 Identity:79/282 - (28%)
Similarity:128/282 - (45%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LIPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKV 126
            |:|::..:...:|:|:..:.....:.|.:.|...:..|.|....:||.:|||::.:.:.:.:..:
Mouse    44 LLPWSPEKINTRFLLYTNENPTAFQTLQLSDPSTIEASNFQVARKTRFIIHGFIDKGEENWVVDM 108

  Fly   127 -KNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEAN 190
             ||.:             ..|:.|.|..|| |..:...|.:.|..|..:||.:|:::..|.:..|
Mouse   109 CKNMF-------------QVEEVNCICVDW-KRGSQTTYTQAANNVRVVGAQVAQMIDILVRNFN 159

  Fly   191 MHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT 255
            .....|::|||||||.:||.||.:..  ....|..|||....|....:|.|:|.|||.:|:.|.|
Mouse   160 YSASKVHLIGHSLGAHVAGEAGSRTP--GLGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHT 222

  Fly   256 S-------VSFGFEQPVGHATFYPNYGKNQKKC--------------------YVYGCSHKRSHD 293
            .       :.||..|.|||..|:||.|:....|                    :| .|:|.||:.
Mouse   223 DAAPLIPFLGFGTNQMVGHFDFFPNGGQYMPGCKKNALSQIVDIDGIWSGTRDFV-ACNHLRSYK 286

  Fly   294 YFIESLTSPAGFWGPRCERHDD 315
            |::||:.:|.||....|..:.|
Mouse   287 YYLESILNPDGFAAYPCASYRD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 78/280 (28%)
Pancreat_lipase_like 71..347 CDD:238363 77/273 (28%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 79/282 (28%)
Pancreat_lipase_like 52..349 CDD:238363 77/274 (28%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.