DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:344 Identity:93/344 - (27%)
Similarity:143/344 - (41%) Gaps:61/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WKKFFK-HLI--PFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMS 116
            |.:.|. .|:  |::..:...:|:|:.....:..:|:...:...::.|.|.....|||.|.||.:
Human    34 WTRTFSTELVGLPWSPEKINTRFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKT 98

  Fly   117 QSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAEL 181
            ..|..  |.:.|..|.|            ||.|.|..||...|.  .|......:..:||.:|..
Human    99 DGKWQ--RDMCNVLLQL------------EDINCINLDWINGSR--EYIHAVNNLRVVGAEVAYF 147

  Fly   182 VRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASD 246
            :..|.::.......|::|||||||.:||.||.:|.  ....|..||||||.|.....|.|:|.||
Human   148 IDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIP--GLGRITGLDPAGPFFHNTPKEVRLDPSD 210

  Fly   247 ASYVESIQTS-------VSFGFEQPVGHATFYPNYGKNQKKC--------------------YVY 284
            |::|:.|.|:       :..|.....||..||||.||:...|                    ..:
Human   211 ANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFF 275

  Fly   285 GCSHKRSHDYFIESLTSPAGFWGPRCERHDD---GTWLLLMSDGEFRMG------GEPSIPKNGT 340
            .|:|.||:.::.||:.:|..|....|..:..   |.......:|...||      ...::..||:
Human   276 DCNHARSYQFYAESILNPDAFIAYPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGS 340

  Fly   341 -FYVKTYSKPPYAMGHRWQ 358
             :::.|.|..|:|   ||:
Human   341 HYFLNTGSLSPFA---RWR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 86/323 (27%)
Pancreat_lipase_like 71..347 CDD:238363 84/312 (27%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 89/335 (27%)
Pancreat_lipase_like 52..348 CDD:238363 84/313 (27%)
PLAT_PL 355..467 CDD:238857 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.