DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:350 Identity:86/350 - (24%)
Similarity:143/350 - (40%) Gaps:88/350 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LIPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKV 126
            :.|::......:|:|:..:..:..:::...:.:.::.|.|....:||.::||::           
  Rat    57 IFPWSPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFI----------- 110

  Fly   127 KNAYLSLTDPGPNG-------EPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRY 184
                    |.|.:|       :....|..|.|..||.:.| ...|.:.:.....:||.:|.||:.
  Rat   111 --------DKGEDGWLLDMCKKMFQVEKVNCICVDWRRGS-RTEYTQASYNTRVVGAEIAFLVQV 166

  Fly   185 LNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASY 249
            |:.|.....::|::|||||||.:.|.||:::..: ...|..||||.|.|:...:|.|:|.|||.:
  Rat   167 LSTEMGYSPENVHLIGHSLGAHVVGEAGRRLEGH-VGRITGLDPAEPCFQGLPEEVRLDPSDAMF 230

  Fly   250 VESIQTS-------VSFGFEQPVGHATFYPNYGKNQKKCY-------------------VYGCSH 288
            |:.|.|.       :.||..|.|||..|:||.||....|.                   ...|:|
  Rat   231 VDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNH 295

  Fly   289 KRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMSDGEFRMGG-----EPSIPKNG--------- 339
            .||:.|:..|:.:|.||.|..|..::           :|:...     |...||.|         
  Rat   296 LRSYKYYASSILNPDGFLGYPCSSYE-----------KFQQNDCFPCPEEGCPKMGHYADQFEGK 349

  Fly   340 ------TFYVKTYSKPPYAMGHRWQ 358
                  |.|:.|.....:.   ||:
  Rat   350 TATVEQTVYLNTGDSGNFT---RWR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 84/339 (25%)
Pancreat_lipase_like 71..347 CDD:238363 83/328 (25%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 84/341 (25%)
Pancreat_lipase_like 65..363 CDD:238363 83/329 (25%)
PLAT_PL 370..482 CDD:238857 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.