DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:297 Identity:86/297 - (28%)
Similarity:131/297 - (44%) Gaps:45/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GDVENLRNSGFDARHQTRIVIHGW-MSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCD 154
            |..|.|.:..|:...:|.:||||| :|....|.:.|:..|..       |.|    :|.||||.|
Zfish    73 GKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALY-------NRE----KDANVIVVD 126

  Fly   155 WSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYR 219
            |..|:.: :|...|:..:.:|..:...:.::.:.:|:..:::::||:||||.:||.||.. ...:
Zfish   127 WLDTAQD-HYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSH-TTNK 189

  Fly   220 FNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT------SVSFGFEQPVGHATFYPNYGKNQ 278
            ...|..||||||.|.......|:...||.:|:.:.|      .:|.|.||||||...|||.|..|
Zfish   190 IGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSFQ 254

  Fly   279 KKCYVYG------------------CSHKRSHDYFIES-LTSPAGFWGPRC---ERHDDGTWLLL 321
            ..|.:.|                  |.|:||...||:| |...|......|   :..|.|..|..
Zfish   255 PGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSCGSNDMFDRGVCLQC 319

  Fly   322 MSDGEFRMGGEPSIPKNG---TFYVKTYSKPPYAMGH 355
            ..:|...:|.:.|..:..   ..:.||....|:.:.|
Zfish   320 RKNGCNTVGYDISKVRKARSVKMFTKTRGSMPFRVFH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 84/291 (29%)
Pancreat_lipase_like 71..347 CDD:238363 84/287 (29%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 86/297 (29%)
Pancreat_lipase_like 51..347 CDD:238363 83/286 (29%)
PLAT_LPL 355..485 CDD:238856 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.