DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl3 and Tengl2

DIOPT Version :9

Sequence 1:NP_608660.3 Gene:Tengl3 / 33404 FlyBaseID:FBgn0051679 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster


Alignment Length:340 Identity:92/340 - (27%)
Similarity:150/340 - (44%) Gaps:81/340 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QWALCALAGVTG-------FVCGAFVQQEASIRQLLQQIRRDPYVYHHRHKLYPMLSTFGTDHEA 67
            :|.|..|..|.|       ||.|.:.|...:.::|.:.|:.|||.|:...|:|.:.:.|.:::| 
  Fly     4 KWQLLGLGFVLGVTALCASFVGGMYFQHTDARKRLRELIQTDPYAYYLSPKIYEVFTFFESNNE- 67

  Fly    68 RLWNRPTSWADKFRELVLSPILDLVSATVTLKWDSATTTDLLDLVKYGLPSTENLYVHKDYVVSQ 132
                      |..|                          :..::|:|.|..::|.::.|:|:|.
  Fly    68 ----------DDHR--------------------------MRQIMKFGFPGLDDLRLYSDFVLSY 96

  Fly   133 DLRTNGVRWICEH---------------------------FR---GDYQRVSSDGGGYSTM---N 164
            |.|.....|:|||                           ||   .||:|...|.|..:..   :
  Fly    97 DRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRSELSDYRRSGFDRGHLAAAGNHH 161

  Fly   165 LRYN---DVYVLSCGSMSICKAFKRKIWNDLENYVSSMAKEFGSVYAYTGPIYTPTCYEIGKWTM 226
            |:.|   |.:.|:..:..:.:.|.|..||:||.||.::...||||:..|||:|.|.....|||.:
  Fly   162 LQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAV 226

  Fly   227 KYEVFDWIPIPVPSHFFKVLIVESGVPGSQPFMEAFIIENSRRVGG-KLNDHRVKVGEIERYTGL 290
            :||:.....:.||:|||||::|||.:...:|:||.:::.|:....| .|......:.|||.|.||
  Fly   227 EYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGL 291

  Fly   291 RFNKIMQPVVQFGKD 305
            :|...::....||.:
  Fly   292 KFFDGLRRSALFGSN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl3NP_608660.3 Endonuclease_NS 125..294 CDD:214889 65/205 (32%)
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.