DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl3 and CG33346

DIOPT Version :10

Sequence 1:NP_608660.3 Gene:Tengl3 / 33404 FlyBaseID:FBgn0051679 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_996301.2 Gene:CG33346 / 2768690 FlyBaseID:FBgn0053346 Length:364 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:48/141 - (34%) Gaps:48/141 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VSATVTLKWDSATTTDLLDLVKYGLPS---TENLYVHKDYVVSQDLRTNGVRW-ICEHF-RGDYQ 151
            |.::.:|.:|....|.:.|   |..|.   ..|.|::   ||.|....|...| |.|:: ||.  
  Fly   192 VPSSRSLSFDRGHLTPVAD---YSFPKILRQTNKYLN---VVPQYYNINRSNWKIVENWVRGQ-- 248

  Fly   152 RVSSDGGGYSTMNLRYNDVYVLSCGSMSICKAFKRKIWNDLENYVSSMAKEFGSVYAYTGPIYTP 216
                            .||..:..|::.:.         ||.|      :...||..|..|...|
  Fly   249 ----------------KDVLNVCTGALGVL---------DLLN------RSQKSVSIYLAPNKNP 282

  Fly   217 TCYEIGKWTMK 227
                :.:||.|
  Fly   283 ----VPRWTYK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl3NP_608660.3 Endonuclease_NS 125..294 CDD:214889 23/105 (22%)
CG33346NP_996301.2 Endonuclease_NS 124..344 CDD:214889 32/141 (23%)

Return to query results.
Submit another query.