DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15387 and c7h12orf57

DIOPT Version :10

Sequence 1:NP_001097058.1 Gene:CG15387 / 33403 FlyBaseID:FBgn0031403 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_988920.1 Gene:c7h12orf57 / 394516 XenbaseID:XB-GENE-5797260 Length:128 Species:Xenopus tropicalis


Alignment Length:99 Identity:28/99 - (28%)
Similarity:64/99 - (64%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DTAKQILMDIIRCVNQPENSKKLSEAKASAGKEMILMMQHVFPLVMQLQLEVIKGHGFPGNREGL 74
            :..|:.|.:::..:..|..|.:|.||:.::|.::..::|.:.|..:|:|.||::.:||..:.||:
 Frog    19 EQVKEALGEVLNALQSPTGSARLEEARENSGNDLGKVLQLLLPAAVQIQQEVLQNYGFSPDGEGV 83

  Fly    75 VQFSQLIREMERDDMEIVRLRSQIRAIYLPPIAI 108
            ::|::|::..|..|.||..:.|::::.:|||:.:
 Frog    84 LRFARLVKSYESQDPEIAAMSSKLKSFFLPPLPL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15387NP_001097058.1 P_C10 7..109 CDD:464416 28/99 (28%)
c7h12orf57NP_988920.1 P_C10 16..111 CDD:464416 25/91 (27%)

Return to query results.
Submit another query.