DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15387 and C12orf57

DIOPT Version :10

Sequence 1:NP_001097058.1 Gene:CG15387 / 33403 FlyBaseID:FBgn0031403 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_612434.1 Gene:C12orf57 / 113246 HGNCID:29521 Length:126 Species:Homo sapiens


Alignment Length:101 Identity:24/101 - (23%)
Similarity:41/101 - (40%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 VSAIGTILDAFG-----NERTALNGNATKF-----------TQIFALDFDHSGQIVSGSIQIMPI 494
            |..:|..|::.|     |...|...::.:|           .:|..|:..|..:|:. :||::| 
Human    38 VQTVGQWLESIGLPQYENHLMANGFDSVQFMGSNVMEDQDLLEIGILNSGHRQRILQ-AIQLLP- 100

  Fly   495 DRMRPAGGSNRGTAGVPRWSFLAGVDGGALRKELLL 530
             :|||.|........|..|  |..::.|...|..|:
Human   101 -KMRPIGHDGYHPTSVAEW--LDSIELGDYTKAFLI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15387NP_001097058.1 P_C10 7..109 CDD:464416
C12orf57NP_612434.1 P_C10 11..113 CDD:464416 18/77 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.