DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sau and golph3l

DIOPT Version :9

Sequence 1:NP_001014460.1 Gene:sau / 33402 FlyBaseID:FBgn0267378 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001032788.1 Gene:golph3l / 569617 ZFINID:ZDB-GENE-051113-168 Length:286 Species:Danio rerio


Alignment Length:288 Identity:169/288 - (58%)
Similarity:215/288 - (74%) Gaps:13/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRSVKPRENGGAEGGLNANTPDDNQDALDNLKDQEDNIDDGDSKETRLTLMEEVLLLGLKDKEGY 73
            |||..|     ||...||...::.:      :::|:..:|.|.|..|||||||:|||||||||||
Zfish     9 RRSEPP-----AERWSNAEEEEEKK------REEEEEEEDTDCKTLRLTLMEEILLLGLKDKEGY 62

  Fly    74 TSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKE 138
            ||||||.||||||.|:|:|||||||:.:|..|.|||.|..||::|||...||||||||||||||.
Zfish    63 TSFWNDSISSGLRSCMLVELGLRGRIQLEPQGTRRRKLLERKVLLKSAAPTGDVLLDEALKHIKN 127

  Fly   139 TDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDN 203
            |:|.|.:.||||.|:||||||:|:.::::||||||||:||||||||||||||||||||||||:|.
Zfish   128 TEPAENMASWIELLTGETWNPMKMHFRMRNVRERLAKSLVEKGVLTTEKQNFLLFDMTTHPLTDR 192

  Fly   204 VVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELL 268
            ..|.||::::|||:|.:|.||.:|:..|||||:.|||.|||:|||.:.|.|:.||:|..|.|.||
Zfish   193 TEKERLLQRVQDSLLDRWTNDSRRISHRMLALLLLAHVSDVLENALSSLPDERYELASTRSRTLL 257

  Fly   269 DLDFEAESAKPN--ANEILWAVFMAFTK 294
            :.|.:.||::.:  |.||:||:..||.|
Zfish   258 EADPDQESSRVSSPAEEIVWAILAAFNK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sauNP_001014460.1 GPP34 58..267 CDD:283397 141/208 (68%)
golph3lNP_001032788.1 GPP34 47..245 CDD:283397 136/197 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3983
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1117244at2759
OrthoFinder 1 1.000 - - FOG0002388
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103565
Panther 1 1.100 - - O PTHR12704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.