DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch and Uchl4

DIOPT Version :9

Sequence 1:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_291085.1 Gene:Uchl4 / 93841 MGIID:1890440 Length:233 Species:Mus musculus


Alignment Length:228 Identity:115/228 - (50%)
Similarity:153/228 - (67%) Gaps:6/228 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68
            |.|||:||||..:::.:||:.|.|...||.|:|.:.|..|||||.|.:||||.:|.||..|.||.
Mouse     6 WLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMESELLSIIPRPVCAVLLLFPITEKYEVFRTEEE 70

  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNAC---GTVALIHSVANNKE-VDIDRG-VLKDFLEKTASLSPE 128
            ::||...:.....:::|:|...|||   ||:.|||::||||: |..:.| .||.|||::.|:|||
Mouse    71 EKIKSQGQDVTSSVYFMKQTISNACGTIGTIGLIHAIANNKDKVHFESGSTLKKFLEESVSMSPE 135

  Fly   129 ERGRALEKDEKFTADHEALAQEGQTNAAN-HEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTS 192
            ||.:.||..:.....||..|.||||.|.: .|||..||||||:.:|.||||||.|.|||.||.||
Mouse   136 ERAKYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGWKPFPINHGKTS 200

  Fly   193 EETFVKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            :||.::|..||||:||.|||:|:||..:||:||
Mouse   201 DETLLEDVIKVCKKFMERDPDELRFNAIALSAA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 111/223 (50%)
Uchl4NP_291085.1 Peptidase_C12_UCH_L1_L3 6..230 CDD:187737 111/223 (50%)
Interaction with ubiquitin. /evidence=ECO:0000250 8..13 3/4 (75%)
Interaction with ubiquitin. /evidence=ECO:0000250 222..227 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I2849
eggNOG 1 0.900 - - E1_KOG1415
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3443
Isobase 1 0.950 - 0 Normalized mean entropy S1557
OMA 1 1.010 - - QHG53971
OrthoDB 1 1.010 - - D1013351at2759
OrthoFinder 1 1.000 - - FOG0001664
OrthoInspector 1 1.000 - - otm43659
orthoMCL 1 0.900 - - OOG6_101218
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1588
SonicParanoid 1 1.000 - - X1061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.820

Return to query results.
Submit another query.