DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch and UCH3

DIOPT Version :9

Sequence 1:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_193484.1 Gene:UCH3 / 827466 AraportID:AT4G17510 Length:234 Species:Arabidopsis thaliana


Alignment Length:223 Identity:88/223 - (39%)
Similarity:135/223 - (60%) Gaps:7/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WTPLESNPEVLTKYIHKLGVSP-AWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEE 67
            |.||||||:|:.:|:..||::| .....||.||:|:.||.:|:||.|.:.|:|.::..|:.|.|:
plant    13 WLPLESNPDVMNQYLWGLGLAPDEAECNDVYGLDDELLEMVPKPVLAVLFLYPITKKSEEERIEQ 77

  Fly    68 HDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVAN-NKEVDIDRGVLKD-FLEKTASLSPEER 130
            ...||  |:.|.:.:::|:|...|||||:.|:|::.| ..|:.:..|...| |.:.||:::|.||
plant    78 DKEIK--EKVHSDKVYFMKQTVGNACGTIGLLHAIGNITSEIKLSDGSFLDRFFKSTANMTPMER 140

  Fly   131 GRALEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEET 195
            .:.||.|.:....|......|.|.|:  |....|||.|...||.||||||||:.||.||.:|..|
plant   141 AKFLENDSQIEDAHSVAVIAGDTPAS--EDADTHFICLACVEGELYELDGRKAGPISHGASSPAT 203

  Fly   196 FVKDAAKVCKEFMARDPNEVRFTVLALT 223
            .:|||.||.|:.:.::|..:.|.::|::
plant   204 LLKDATKVIKKMIEKNPGSLNFNLIAIS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 87/220 (40%)
UCH3NP_193484.1 Peptidase_C12_UCH_L1_L3 13..230 CDD:187737 87/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1303
eggNOG 1 0.900 - - E1_KOG1415
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4377
Inparanoid 1 1.050 168 1.000 Inparanoid score I1562
OMA 1 1.010 - - QHG53971
OrthoDB 1 1.010 - - D1013351at2759
OrthoFinder 1 1.000 - - FOG0001664
OrthoInspector 1 1.000 - - oto4192
orthoMCL 1 0.900 - - OOG6_101218
Panther 1 1.100 - - LDO PTHR10589
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1061
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.