DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch and uchl3

DIOPT Version :9

Sequence 1:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001019576.1 Gene:uchl3 / 554104 ZFINID:ZDB-GENE-050522-158 Length:230 Species:Danio rerio


Alignment Length:226 Identity:120/226 - (53%)
Similarity:160/226 - (70%) Gaps:5/226 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68
            |.|||:||||:.:::.:||:.|.|...||.|||.:.|..:||||.|.:||||.:|.||..|.||.
Zfish     6 WLPLEANPEVMNQFLRQLGLVPTWQFGDVYGLELEVLSLVPRPVCAVLLLFPITEKYETFRQEEE 70

  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNK---EVDIDRGVLKDFLEKTASLSPEER 130
            .:||...::...|:::|:|...|||||:.|||:||||:   |.::: ..||.||.::|.:||||:
Zfish    71 AKIKGQGQEVSSDVYFMKQTIGNACGTIGLIHAVANNQNHLEFELN-SPLKTFLLQSAKMSPEEK 134

  Fly   131 GRALEKDEKFTADHEALAQEGQTNAAN-HEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEE 194
            ...|||||.....||:.||||||.|.. .|||..||||.||.:|.||||||||.|||.||.|:|:
Zfish   135 AAFLEKDESIRVTHESSAQEGQTEAPGLDEKVDLHFIAFVNVDGHLYELDGRKPFPIVHGKTTED 199

  Fly   195 TFVKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            ||::|:|:|||:||||||.|:||||:||:.|
Zfish   200 TFLEDSAEVCKKFMARDPQELRFTVVALSKA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 117/221 (53%)
uchl3NP_001019576.1 Peptidase_C12_UCH_L1_L3 6..227 CDD:187737 117/221 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2729
eggNOG 1 0.900 - - E1_KOG1415
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4377
Inparanoid 1 1.050 235 1.000 Inparanoid score I3374
OMA 1 1.010 - - QHG53971
OrthoDB 1 1.010 - - D1013351at2759
OrthoFinder 1 1.000 - - FOG0001664
OrthoInspector 1 1.000 - - oto41256
orthoMCL 1 0.900 - - OOG6_101218
Panther 1 1.100 - - LDO PTHR10589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1588
SonicParanoid 1 1.000 - - X1061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.