DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch and uchl3

DIOPT Version :9

Sequence 1:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001017120.1 Gene:uchl3 / 549874 XenbaseID:XB-GENE-980858 Length:230 Species:Xenopus tropicalis


Alignment Length:227 Identity:115/227 - (50%)
Similarity:158/227 - (69%) Gaps:3/227 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAE 66
            |.|.|||:||:::.:::.:|||..:|...||.||:.:.|..|||||.|.:||||.:|.||..|||
 Frog     4 LRWLPLEANPDLMNQFLKQLGVGSSWQFVDVYGLDPELLSMIPRPVCAVLLLFPVTEKYETFRAE 68

  Fly    67 EHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDID-RGVLKDFLEKTASLSPEE 129
            |.::||...::....:::|:|...|||||:.|||:||||:| :|.: ...||.|||::.||||||
 Frog    69 EEEKIKSHGQKLDSSVYFMKQTIRNACGTIGLIHTVANNREKLDFECDSALKKFLEESVSLSPEE 133

  Fly   130 RGRALEKDEKFTADHEALAQEGQTNAAN-HEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSE 193
            |.|.|||||.....||..|||||:.|.: .:||..||:|..:.:|.||||||||.||:.||.|:|
 Frog   134 RARFLEKDESIRVTHENTAQEGQSEAPSLDDKVDLHFVAFAHIKGHLYELDGRKPFPVNHGQTTE 198

  Fly   194 ETFVKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            ||..:||.:||:.||.|||:|:||||:|.:.|
 Frog   199 ETMFEDAIEVCRNFMLRDPDELRFTVIAFSKA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 112/220 (51%)
uchl3NP_001017120.1 Peptidase_C12_UCH_L1_L3 6..227 CDD:187737 112/220 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4377
Inparanoid 1 1.050 232 1.000 Inparanoid score I3353
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013351at2759
OrthoFinder 1 1.000 - - FOG0001664
OrthoInspector 1 1.000 - - oto104289
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1588
SonicParanoid 1 1.000 - - X1061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.