DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch and uchl1

DIOPT Version :9

Sequence 1:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001011321.1 Gene:uchl1 / 496780 XenbaseID:XB-GENE-1000432 Length:234 Species:Xenopus tropicalis


Alignment Length:213 Identity:92/213 - (43%)
Similarity:137/213 - (64%) Gaps:8/213 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEHDRIKEVEEQH 78
            |::.:.:|||...|...||:|.||::|..:..||.|.:||||.:..:|..|   ..:|||::|:.
 Frog    24 LSEVLAQLGVLDGWKFVDVLGFEDESLSNVLTPVCAVLLLFPLTPQHENFR---QSQIKELQEKD 85

  Fly    79 P-EDLFYMRQFTHNACGTVALIHSVANNKEV--DIDRGVLKDFLEKTASLSPEERGRALEKDEKF 140
            . :.:::::|...|:||||.|||:.||||:.  ..:..|||:|:|:||:||||||.:.|||.|..
 Frog    86 ANKKVYFLKQTIGNSCGTVGLIHAAANNKDKLNFAENSVLKNFIEETATLSPEERAKHLEKHEAI 150

  Fly   141 TADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVKDAAKVCK 205
            .:.|.::|.|||  ...:..|..|||.....:|.|||||||...|::|..|||||.:|||||:|:
 Frog   151 KSAHNSVAAEGQ--CRENSDVNFHFILFTAVDGHLYELDGRLPSPVEHDATSEETLLKDAAKICR 213

  Fly   206 EFMARDPNEVRFTVLALT 223
            :|..|:..||||:.:||:
 Frog   214 QFTEREQGEVRFSAVALS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 90/210 (43%)
uchl1NP_001011321.1 Peptidase_C12_UCH_L1_L3 24..230 CDD:187737 90/210 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53971
OrthoDB 1 1.010 - - D1013351at2759
OrthoFinder 1 1.000 - - FOG0001664
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1588
SonicParanoid 1 1.000 - - X1061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.