DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10874 and Ccdc28b

DIOPT Version :9

Sequence 1:NP_001259911.1 Gene:CG10874 / 33394 FlyBaseID:FBgn0031395 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001128161.1 Gene:Ccdc28b / 682445 RGDID:1583447 Length:200 Species:Rattus norvegicus


Alignment Length:109 Identity:50/109 - (45%)
Similarity:65/109 - (59%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 HSFVSEVPDVKHMERALLGLLDDFHSGKLRAFAGSGCTMDQMTKIREQQESLAKLHFELAAA--- 273
            |||::||.||..||..||.||:|||||:|:|| |..|:.:|:..:||.||.||:|||.|...   
  Rat    79 HSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAF-GKECSFEQLEHVREMQEKLARLHFSLDVCGEE 142

  Fly   274 -----EEDSLEHG--NEFNTNKAQENMLQLMQRLEQLSISIEQL 310
                 |||.:..|  .|.....|..|:.||:..||.||.||::|
  Rat   143 EDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10874NP_001259911.1 DUF4061 219..307 CDD:290010 42/97 (43%)
Ccdc28bNP_001128161.1 DUF4061 86..184 CDD:404199 43/98 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341540
Domainoid 1 1.000 72 1.000 Domainoid score I9109
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1460268at2759
OrthoFinder 1 1.000 - - FOG0003935
OrthoInspector 1 1.000 - - otm45575
orthoMCL 1 0.900 - - OOG6_107733
Panther 1 1.100 - - O PTHR13400
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2708
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.