DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10874 and Ccdc28b

DIOPT Version :9

Sequence 1:NP_001259911.1 Gene:CG10874 / 33394 FlyBaseID:FBgn0031395 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_030109556.1 Gene:Ccdc28b / 66264 MGIID:1913514 Length:256 Species:Mus musculus


Alignment Length:160 Identity:57/160 - (35%)
Similarity:80/160 - (50%) Gaps:23/160 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QHSNSNQNTPRLQRRKNPTASMPNASAHSDKFDDRPI------------KHHSFVSEVPDVKHME 225
            :.:.|...|..|.|....:.::..:...:.|...||:            ..|||::||.||..||
Mouse    84 EETPSRPRTSDLSRVTEASWALGQSPCRAGKEKCRPVLAGGGGGSAGTPLQHSFLTEVTDVYEME 148

  Fly   226 RALLGLLDDFHSGKLRAFAGSGCTMDQMTKIREQQESLAKLHFELAAA--------EEDSLEHG- 281
            ..||.||:|||||:|:|| |..|:.:|:..:||.||.||:|||.|...        |||.:..| 
Mouse   149 GGLLNLLNDFHSGRLQAF-GKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDEEEEEDGVTEGL 212

  Fly   282 -NEFNTNKAQENMLQLMQRLEQLSISIEQL 310
             .|.....|..|:.||:..||.||.||::|
Mouse   213 PEEQKKTMADRNLDQLLSNLEDLSNSIQKL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10874NP_001259911.1 DUF4061 219..307 CDD:290010 42/97 (43%)
Ccdc28bXP_030109556.1 DUF4061 142..240 CDD:372543 43/98 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837791
Domainoid 1 1.000 72 1.000 Domainoid score I9304
eggNOG 1 0.900 - - E1_2C318
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003935
OrthoInspector 1 1.000 - - otm43510
orthoMCL 1 0.900 - - OOG6_107733
Panther 1 1.100 - - O PTHR13400
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5580
SonicParanoid 1 1.000 - - X2708
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.