DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10874 and ccdc28b

DIOPT Version :9

Sequence 1:NP_001259911.1 Gene:CG10874 / 33394 FlyBaseID:FBgn0031395 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001139045.1 Gene:ccdc28b / 559814 ZFINID:ZDB-GENE-060208-3 Length:213 Species:Danio rerio


Alignment Length:157 Identity:56/157 - (35%)
Similarity:84/157 - (53%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PNNNNQHSNSNQNTPRLQRRKNPTASMPNASAHSDKFDDRPIKHHSFVSEVPDVKHMERALLGLL 232
            |.|...|            |:.|.|..|...:...: ...|:: |:|:::|.||:.||..||.||
Zfish    75 PKNTRPH------------REKPRAPQPAGPSRVSQ-SSSPLQ-HTFLTDVSDVREMEGGLLNLL 125

  Fly   233 DDFHSGKLRAFAGSGCTMDQMTKIREQQESLAKLHFELAAAEEDSLEHGNEFNTNKAQENMLQLM 297
            :|||||||:|| |..|:.:|:..:||.||.||:|||.|.:..|:..|   :...|.:..|:..|:
Zfish   126 NDFHSGKLQAF-GKVCSFEQLEHVREMQERLARLHFSLDSHVEELSE---DQRKNASDRNLEHLL 186

  Fly   298 QRLEQLSISIEQL---------QTSHT 315
            ..||:||.||::|         :||:|
Zfish   187 SNLEELSTSIQKLHLAENQDLPKTSNT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10874NP_001259911.1 DUF4061 219..307 CDD:290010 39/87 (45%)
ccdc28bNP_001139045.1 DUF4061 112..196 CDD:290010 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581546
Domainoid 1 1.000 74 1.000 Domainoid score I9120
eggNOG 1 0.900 - - E1_2C318
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1460268at2759
OrthoFinder 1 1.000 - - FOG0003935
OrthoInspector 1 1.000 - - oto40264
orthoMCL 1 0.900 - - OOG6_107733
Panther 1 1.100 - - O PTHR13400
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5580
SonicParanoid 1 1.000 - - X2708
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.