DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10874 and Ccdc28a

DIOPT Version :9

Sequence 1:NP_001259911.1 Gene:CG10874 / 33394 FlyBaseID:FBgn0031395 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001333680.1 Gene:Ccdc28a / 215814 MGIID:2443508 Length:192 Species:Mus musculus


Alignment Length:182 Identity:59/182 - (32%)
Similarity:94/182 - (51%) Gaps:23/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PTATDNHNTPKNNNNDSTKPNN-----NNQHSNSNQNTPRLQR---RKNPTASMPNASAHSDKFD 205
            |.:...|:|...|...:..|::     :|..|.|....|:|:|   .||.........|.|    
Mouse    11 PKSFSAHSTQVVNAKKNAIPSSKSTGFSNPTSQSASQRPKLKRVMKEKNKPPGGEGKGAQS---- 71

  Fly   206 DRPIKHHSFVSEVPDVKHMERALLGLLDDFHSGKLRAFAGSGCTMDQMTKIREQQESLAKLHF-- 268
             .||: |||:::|.||:.|||.||.||:|||||||:|| |:.|:::||..:|..||.||:|:.  
Mouse    72 -TPIQ-HSFLTDVSDVQEMERGLLSLLNDFHSGKLQAF-GNECSIEQMEHVRGMQEKLARLNLEL 133

  Fly   269 --ELAAAEEDSLEHGNEFNTNK----AQENMLQLMQRLEQLSISIEQLQTSH 314
              ||....||..:..::.|.::    ..|.:.|.::.|..|:...:.:.::|
Mouse   134 YGELEELPEDKRKAASDANLDRLLSDGAEKLTQRLKVLAALAEDPDSVSSTH 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10874NP_001259911.1 DUF4061 219..307 CDD:290010 37/95 (39%)
Ccdc28aNP_001333680.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837792
Domainoid 1 1.000 72 1.000 Domainoid score I9304
eggNOG 1 0.900 - - E1_2C318
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1460268at2759
OrthoFinder 1 1.000 - - FOG0003935
OrthoInspector 1 1.000 - - otm43510
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13400
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5580
SonicParanoid 1 1.000 - - X2708
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.