DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10874 and ccdc28a

DIOPT Version :9

Sequence 1:NP_001259911.1 Gene:CG10874 / 33394 FlyBaseID:FBgn0031395 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_002939033.1 Gene:ccdc28a / 100488522 XenbaseID:XB-GENE-6051299 Length:205 Species:Xenopus tropicalis


Alignment Length:165 Identity:58/165 - (35%)
Similarity:92/165 - (55%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PTATDNHNTPKNNNNDSTKPNN-----NNQHSNSNQNTPRLQR-RKNPTASMPNASAHSDKFDDR 207
            |.::.:|..|..|:..::.|.:     :|..:......|:|:| .|..:.|.....|.|    ..
 Frog    11 PKSSTSHPPPLVNSKRNSVPLSKSTGFSNVVAQPTGQKPKLKRVFKEKSKSQGEGKAVS----SA 71

  Fly   208 PIKHHSFVSEVPDVKHMERALLGLLDDFHSGKLRAFAGSGCTMDQMTKIREQQESLAKLHFELAA 272
            ||: |||:::|.||:.||:.||.||:|||||||.|| |:.|:::||..:|..||.||:||.||..
 Frog    72 PIQ-HSFLTDVSDVQEMEKGLLSLLNDFHSGKLEAF-GNECSIEQMEHVRGMQEKLARLHLELYG 134

  Fly   273 AEEDSLEHGNEFNTNKAQENMLQLMQRLEQLSISI 307
            ..|:..|...:..::   .|:.:|:..||:|:.||
 Frog   135 ELEELPEDKRKITSD---SNLDRLLCDLEELNSSI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10874NP_001259911.1 DUF4061 219..307 CDD:290010 37/87 (43%)
ccdc28aXP_002939033.1 DUF4061 82..166 CDD:372543 37/87 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8898
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1460268at2759
OrthoFinder 1 1.000 - - FOG0003935
OrthoInspector 1 1.000 - - otm48663
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2708
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.