DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and fev

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001315078.1 Gene:fev / 791175 ZFINID:ZDB-GENE-070112-1852 Length:235 Species:Danio rerio


Alignment Length:240 Identity:75/240 - (31%)
Similarity:101/240 - (42%) Gaps:77/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 TAGPVVTPAGGS------ISAPTTPSYMYKAKREFFPENSEP-----NT-----NGRL-LWDFLQ 403
            ||..:....|||      :|.||         .....|:..|     ||     :|:: ||.||.
Zfish    10 TATTMRQNCGGSLMFNMYLSDPT---------ENLLKESKSPSWTPINTGVQKGSGQIQLWQFLL 65

  Fly   404 QLLNDRNQKYSDLIAWKCRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRK 468
            :||:|  ......|||: ...|.||::||..:|:.||.:|:..:|||||:||||||||..||:.|
Zfish    66 ELLSD--SANMTCIAWE-GTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK 127

  Fly   469 VQGERHCYQFLRN-----------------------PTELKNIKNISLLRQSTPANGNGGSPSMP 510
            |.|:|:.|:|..|                       |.:...|..::|:     |.|.|     |
Zfish   128 VHGKRYAYKFDFNGLAQVCQPSSTEQAIYKFQSNFAPIQFSGISKLNLV-----APGVG-----P 182

  Fly   511 QGSSQAPGSPAGQNWNPQQQSQQQQQSPQRPASRNGPMSLPAVAA 555
            .|.|..||||      |........|.|       ||..  ||:|
Zfish   183 SGFSYWPGSP------PTLYHSHNLQPP-------GPFG--AVSA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 42/110 (38%)
fevNP_001315078.1 ETS 57..142 CDD:197710 41/87 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.