Sequence 1: | NP_001259908.1 | Gene: | aop / 33392 | FlyBaseID: | FBgn0000097 | Length: | 732 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001315341.1 | Gene: | gabpa / 58110 | ZFINID: | ZDB-GENE-011010-2 | Length: | 455 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 66/197 - (33%) |
---|---|---|---|
Similarity: | 102/197 - (51%) | Gaps: | 27/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 WSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPV-VTPAGGSISAPTTP 374
Fly 375 SYMYKAKREFFP-----ENSEP----NTNGRL-LWDFLQQLLNDRNQKYSDLIAWKCRDTGVFKI 429
Fly 430 VDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQF---LR-----NPTELK 486
Fly 487 NI 488 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
aop | NP_001259908.1 | SAM_PNT-Tel_Yan | 49..116 | CDD:176085 | |
ETS | 395..482 | CDD:197710 | 41/95 (43%) | ||
gabpa | NP_001315341.1 | GABP-alpha | 40..118 | CDD:288472 | |
SAM_PNT-GABP-alpha | 162..248 | CDD:176084 | 4/28 (14%) | ||
ETS | 309..394 | CDD:197710 | 38/87 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |