DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and gabpa

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001315341.1 Gene:gabpa / 58110 ZFINID:ZDB-GENE-011010-2 Length:455 Species:Danio rerio


Alignment Length:197 Identity:66/197 - (33%)
Similarity:102/197 - (51%) Gaps:27/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 WSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPV-VTPAGGSISAPTTP 374
            :||::..|:......:.:.....:::.|..|.|.|:  ..:|:|.   || :.||....:.||..
Zfish   219 FSQEEFLQRVPSGEILWSHLELLRKYVLASQDQSQE--ATVTIDQ---PVQIIPAPVQQATPTAI 278

  Fly   375 SYMYKAKREFFP-----ENSEP----NTNGRL-LWDFLQQLLNDRNQKYSDLIAWKCRDTGVFKI 429
            ..|...|....|     |.|.|    ..||:: ||.||.:||.|::.:  |.|:| ..:.|.||:
Zfish   279 KVMKHNKTPRAPRISGEERSSPGNRTGNNGQIQLWQFLLELLTDKDSR--DCISW-VGEEGEFKL 340

  Fly   430 VDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQF---LR-----NPTELK 486
            ..|..:|:.||.:||..:|||:|:||||||||..:::.||||:|..|:|   ||     :..||.
Zfish   341 NQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMISKVQGKRFVYKFVCDLRTLIGYSAAELN 405

  Fly   487 NI 488
            |:
Zfish   406 NL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 41/95 (43%)
gabpaNP_001315341.1 GABP-alpha 40..118 CDD:288472
SAM_PNT-GABP-alpha 162..248 CDD:176084 4/28 (14%)
ETS 309..394 CDD:197710 38/87 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.