DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and ETV3L

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001004341.1 Gene:ETV3L / 440695 HGNCID:33834 Length:361 Species:Homo sapiens


Alignment Length:323 Identity:93/323 - (28%)
Similarity:133/323 - (41%) Gaps:67/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 PA--GGSISAPTTPSYMYKAKREFFPENSEPNTNGRLLWDFLQQLLNDRNQKYSDLIAWKCRDTG 425
            ||  |..||....|.:.|||:       |.|.:....||.|:.:||  :.:::..:|||:..:.|
Human    11 PANPGNWISGLAFPDWAYKAE-------SSPGSRQIQLWHFILELL--QKEEFRHVIAWQQGEYG 66

  Fly   426 VFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQFLRNPTELKNIKN 490
            .|.|.||..:|:|||.:|....|||||:||||||||...||.|.:|:|..|:|  |.::| .:.|
Human    67 EFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKF--NFSKL-IVVN 128

  Fly   491 ISLLRQSTPANGN--GGSPSM------PQG---------------------SSQAPGSPAGQNWN 526
            ..|.....|.:.:  .|:|::      |.|                     ..|.|..|      
Human   129 YPLWEVRAPPSPHLLLGAPALCRPALVPVGVQSELLHSMLFAHQAMVEQLTGQQTPRGP------ 187

  Fly   527 PQQQSQQQ--QQSPQRPASRNGPMSLPAVAAVAAA-----AAAAYGP--PPTSPLFMHAINGAF- 581
            |:....::  ..|..|..|..||..|.....:.:.     ..|::.|  ||..|.....::|.| 
Human   188 PETSGDKKGSSSSVYRLGSAPGPCRLGLCCHLGSVQGELPGVASFTPPLPPPLPSNWTCLSGPFL 252

  Fly   582 HYLSAAAAGPPPNSPALNTPSAVGGPDKFQFHPLKLENGSGSGSESAGE-----DLKPTDLSV 639
            ..|.:....|....|.:..|.....|..:.|..|.|..|.|.|   |||     .|:|..|.|
Human   253 PPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQG---AGERLWLLSLRPEGLEV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 38/86 (44%)
ETV3LNP_001004341.1 ETS 38..124 CDD:197710 39/89 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..201 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.