DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and Elf5

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_008760292.1 Gene:Elf5 / 366142 RGDID:1305859 Length:254 Species:Rattus norvegicus


Alignment Length:94 Identity:35/94 - (37%)
Similarity:57/94 - (60%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 NSEPNTNGRLLWDFLQQLLNDRNQKYSDLIAWKCRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDK 452
            ::..|.....||:|::.||....:. ..::.|:.|:.|:|::|....|||:||.:|.:..|.|:|
  Rat   154 HTRTNLQSSHLWEFVRDLLLSPEEN-CGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEK 217

  Fly   453 MSRALRYYYRVNILRKVQGERHCYQFLRN 481
            :||||||||:..||.:|. .|..|:|.:|
  Rat   218 LSRALRYYYKTGILERVD-RRLVYKFGKN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 34/87 (39%)
Elf5XP_008760292.1 SAM_superfamily 42..123 CDD:301707
ETS 163..247 CDD:197710 34/85 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.