DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and EHF

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001193545.1 Gene:EHF / 26298 HGNCID:3246 Length:322 Species:Homo sapiens


Alignment Length:274 Identity:70/274 - (25%)
Similarity:112/274 - (40%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SNGSQPNIMPMKGISSASSNH--SDSEEEYSETSGGVSKMPPAPLSYSTASPPGTPILKDIKPNW 299
            :|....|.:|.:.. ..:..|  |.|.:|::..:|...:     |.||.        |:.:|.|.
Human    87 TNQLDANCIPFQEF-DINGEHLCSMSLQEFTRAAGTAGQ-----LLYSN--------LQHLKWNG 137

  Fly   300 ----------------TQQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLP 348
                            |:|...|.:|:|..:.........:.|..:.::                
Human   138 QCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSK---------------- 186

  Fly   349 QKLTLDNTAGPVVTPAGGSISAPTTPSYMYKAKREFFPENSEP---------NTNGRLLWDFLQQ 404
                         |.....||. ||.|::..|:.....:..:|         |..|..||:|::.
Human   187 -------------TFCRAQISM-TTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRD 237

  Fly   405 -LLN-DRNQKYSDLIAWKCRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILR 467
             ||| |:|   ..||.|:.|..|||:.:....:|:|||.:||:.||.|:|:|||:||||:..||.
Human   238 ILLNPDKN---PGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILE 299

  Fly   468 KVQGERHCYQFLRN 481
            :|.|.|..|:|.:|
Human   300 RVDGRRLVYKFGKN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 41/89 (46%)
EHFNP_001193545.1 SAM_PNT-ESE-3-like 61..138 CDD:188882 14/64 (22%)
ETS 228..315 CDD:197710 41/89 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.