DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and ets-9

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001371009.1 Gene:ets-9 / 180702 WormBaseID:WBGene00016865 Length:225 Species:Caenorhabditis elegans


Alignment Length:279 Identity:72/279 - (25%)
Similarity:102/279 - (36%) Gaps:114/279 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 SYSTASPPGTPILKDIKPNWTQQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQ 344
            :|...||| ||             |||.:..|:|             .::|              
 Worm    25 TYPDISPP-TP-------------TNSHIRCWAQ-------------FSIA-------------- 48

  Fly   345 QQLPQKLTLDNTAGPVVTPAGGSISAPTTPSYMYKAKREFFP---ENSEPNTNGRL--------L 398
            ||||                   .:.|:.|:       ..||   .|.||.|:..|        |
 Worm    49 QQLP-------------------CAVPSFPT-------SLFPLPIMNDEPMTDDELVKMKGPSRL 87

  Fly   399 WDFLQQL-LNDRNQKYSDLIAWKCRDTG---VFKIVDPAGLAKLWGIQK-NHLSMNYDKMSRALR 458
            ..||..| :|:|.:|   .:.|    ||   .|.:|:...:||:||.:| |...|:|.|:|||:|
 Worm    88 IGFLVHLAMNERARK---ALRW----TGNGLEFVLVNKELVAKMWGNRKHNTKDMDYYKLSRAIR 145

  Fly   459 YYYR------VNI----LRKVQGER--------HCYQFLRNPTELKNIKNISLLRQSTPANGNGG 505
            ..|.      .||    |:|  |.|        |.|..|.|.||    |:|:.:.:.....|...
 Worm   146 EKYEKKDKADKNIKPGKLKK--GTRTYSYVFTEHAYPDLMNQTE----KDINFITRFAADIGQKY 204

  Fly   506 SPSMPQGSSQAPGSPAGQN 524
            |.:....:..:|.||:.||
 Worm   205 SDNSDLNNVNSPKSPSPQN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 36/117 (31%)
ets-9NP_001371009.1 Ets 86..>150 CDD:413392 26/70 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.