DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and Elf5

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001139285.1 Gene:Elf5 / 13711 MGIID:1335079 Length:253 Species:Mus musculus


Alignment Length:84 Identity:34/84 - (40%)
Similarity:54/84 - (64%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 LWDFLQQLLNDRNQKYSDLIAWKCRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYR 462
            ||:|::.||....:. ..::.|:.|:.|:|::|....|||:||.:|.:..|.|:|:||||||||:
Mouse   163 LWEFVRDLLLSPEEN-CGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYK 226

  Fly   463 VNILRKVQGERHCYQFLRN 481
            ..||.:|. .|..|:|.:|
Mouse   227 TGILERVD-RRLVYKFGKN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 34/84 (40%)
Elf5NP_001139285.1 SAM_PNT-ESE-2-like 39..122 CDD:188881
ETS 162..246 CDD:197710 34/84 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.