DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and Ehf

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_006498758.1 Gene:Ehf / 13661 MGIID:1270840 Length:311 Species:Mus musculus


Alignment Length:257 Identity:67/257 - (26%)
Similarity:107/257 - (41%) Gaps:75/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SSNH--SDSEEEYSETSGGVSKMPPAPLSYSTASPPGTPILKDIKPNW----------------T 300
            |..|  |.|.:|::..:|...:     |.||.        |:.:|.|.                |
Mouse    92 SGEHLCSMSLQEFTRAAGSAGQ-----LLYSN--------LQHLKWNGQCSSDLFQSAHNVIVKT 143

  Fly   301 QQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPVVTPAG 365
            :|...|.:|:|.::.........:.|..:.::                             |...
Mouse   144 EQTDPSIMNTWKEENYLYDPSYGSTVDLLDSK-----------------------------TFCR 179

  Fly   366 GSISAPTTPSYMYKA------KREFFPENS---EPNTNGRLLWDFLQQLL--NDRNQKYSDLIAW 419
            ..||. ||.|::..|      |.:..|..|   :.|..|..||:|::.:|  .|:|   ..||.|
Mouse   180 AQISM-TTSSHLPVAESPDMKKEQDHPVKSHTKKHNPRGTHLWEFIRDILLSPDKN---PGLIKW 240

  Fly   420 KCRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQFLRN 481
            :.|..|:|:.:....:|:|||.:||:.||.|:|:|||:||||:..||.:|.|.|..|:|.:|
Mouse   241 EDRSEGIFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 395..482 CDD:197710 38/89 (43%)
EhfXP_006498758.1 SAM_PNT-ESE-3-like 50..127 CDD:188882 12/47 (26%)
ETS 217..304 CDD:197710 38/89 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.