DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aop and LOC101734178

DIOPT Version :9

Sequence 1:NP_001259908.1 Gene:aop / 33392 FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_031752646.1 Gene:LOC101734178 / 101734178 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:160 Identity:53/160 - (33%)
Similarity:77/160 - (48%) Gaps:37/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SQLAELKTQLPPSLPSDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKALCLLTRADFGHR 98
            |.:.::.:::|.||...|.|||::||:.:||:..:|..|.:.|...|.|||:|||:||:.||..|
 Frog    41 SIIEDVISKVPGSLRIHPSLWSKDDVIQWLRWAEKECSLRRTDDKKFVMNGRALCILTKEDFKKR 105

  Fly    99 CPGAGDVLHNVLQMLIIESHMMQWHLPNSPVTPTS----RYPLSPHS------HPPTPTWPPLNA 153
            .|.:||||:.:|:.  |::|...  |.|.|....|    .| |..||      |.|         
 Frog   106 SPSSGDVLYELLRH--IKTHRKA--LVNHPFISKSIRKMNY-LQLHSCAKRGVHAP--------- 156

  Fly   154 PPENSPFHSSAHSLAGHHFMAPNSVTLSPP 183
                ||.|...:.|.|         .|:||
 Frog   157 ----SPGHMQGNPLLG---------VLTPP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085 29/66 (44%)
ETS 395..482 CDD:197710
LOC101734178XP_031752646.1 SAM_superfamily 56..122 CDD:417767 30/67 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357152at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.