DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and TRR2

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_011974.1 Gene:TRR2 / 856506 SGDID:S000001148 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:51/258 - (19%)
Similarity:96/258 - (37%) Gaps:77/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 FKQWTGSERSLFFEPDEFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECL 382
            |:.||           ||..|.|.:..:|   |.:|.|.|.|::..        .|.|..:.:.:
Yeast   120 FRLWT-----------EFNEDAEPVTTDA---IILATGASAKRMHL--------PGEETYWQQGI 162

  Fly   383 IATGCAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELACSLAHY 447
            .|.......:|:.|:.|                            :.::|.|....|.|..|..|
Yeast   163 SACAVCDGAVPIFRNKP----------------------------LAVIGGGDSACEEAEFLTKY 199

  Fly   448 SRENNGGKVYQVFQENANMSKVL--------PNYLSRWTTAKMEAQGVCVIPNASIRSAVRDETN 504
            :     .|||.:.:::...:.|:        ||.:..:.|..:||:|     :..:.:.:|.: |
Yeast   200 A-----SKVYILVRKDHFRASVIMQRRIEKNPNIIVLFNTVALEAKG-----DGKLLNMLRIK-N 253

  Fly   505 LKLELNNGMTLMSDVVVVCVGCTPNTDLAGPSRLEVDRSLGGF---VVNAELEARRNLYVAGD 564
            .|..:.|.:.:  :.:...:|.:|.||:.   :.:||....|:   |..:.|.:....:.|||
Yeast   254 TKSNVENDLEV--NGLFYAIGHSPATDIV---KGQVDEEETGYIKTVPGSSLTSVPGFFAAGD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 51/258 (20%)
Pyr_redox 427..512 CDD:278498 19/92 (21%)
AIF_C 591..720 CDD:291391
TRR2NP_011974.1 TRX_reduct 28..338 CDD:273540 51/258 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.