DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and Sqor

DIOPT Version :10

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_067482.4 Gene:Sqor / 59010 MGIID:1929899 Length:450 Species:Mus musculus


Alignment Length:89 Identity:24/89 - (26%)
Similarity:35/89 - (39%) Gaps:22/89 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 RFKQWTGSERSLFFEPDE-FFIDP---------EDLDDNANGGIAVAQGFSVKKVDAQKRIVTLN 371
            |.|:..|:|.....||.| .|..|         ::|..:....::|... .|:.:  |.|:..||
Mouse    61 RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSLSVRSTLSVIPS-GVQWI--QDRVAELN 122

  Fly   372 ---------DGYEISYDECLIATG 386
                     .|.||||...:||.|
Mouse   123 PDENCIRTDSGKEISYRYLIIALG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 NirB 256..719 CDD:440863 24/89 (27%)
AIF_C 591..721 CDD:464279
SqorNP_067482.4 FadH2 71..389 CDD:440215 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.