DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and Sqor

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001155975.1 Gene:Sqor / 59010 MGIID:1929899 Length:450 Species:Mus musculus


Alignment Length:89 Identity:24/89 - (26%)
Similarity:35/89 - (39%) Gaps:22/89 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 RFKQWTGSERSLFFEPDE-FFIDP---------EDLDDNANGGIAVAQGFSVKKVDAQKRIVTLN 371
            |.|:..|:|.....||.| .|..|         ::|..:....::|... .|:.:  |.|:..||
Mouse    61 RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSLSVRSTLSVIPS-GVQWI--QDRVAELN 122

  Fly   372 ---------DGYEISYDECLIATG 386
                     .|.||||...:||.|
Mouse   123 PDENCIRTDSGKEISYRYLIIALG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 24/89 (27%)
Pyr_redox 427..512 CDD:278498
AIF_C 591..720 CDD:291391
SqorNP_001155975.1 FadH2 46..397 CDD:223523 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.