DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and aifm5

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_001920911.2 Gene:aifm5 / 557064 ZFINID:ZDB-GENE-091118-96 Length:543 Species:Danio rerio


Alignment Length:393 Identity:101/393 - (25%)
Similarity:169/393 - (43%) Gaps:66/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 PKHVPY------------LIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWY 304
            ||.|.:            :::|||.|.......::..:...:::|:|.:...||.:..|||.:  
Zfish   125 PKRVKWMGVRDQSVSHTVMLLGGGAACLMCAETLRQENYGGRIIMVSRDDLLPYDKTRLSKVM-- 187

  Fly   305 TPNPNEDPIKDYRFKQWTGSERSLFFEPD-EFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIV 368
              |...|.:...|.        ..|.:.| |.::..|.|                 .:|..|:.|
Zfish   188 --NAESDSLLMRRM--------DFFHKHDIEVWLKKEAL-----------------SIDTNKKTV 225

  Fly   369 TLNDGYEISYDECLIATGCAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGN 433
            |.:||...|||:.||||||..|.|    |.|.:.||:|::..||:|...:.......|:: |||.
Zfish   226 TFDDGLIQSYDQILIATGCRAKGL----DCPGANLERVLMLETPEDARCVHYACTGCRTV-IVGT 285

  Fly   434 GFIGSELACSLAHYSRENNGGKVYQVFQENANMSKVLPNYLSRWTTAKMEAQGVCVIPNASIRSA 498
            .|||.|:|..|.     :....:..:........|.|...:.:.|...:|.:||....|.::...
Zfish   286 SFIGMEVAAYLL-----DTSSSMTVIGSSELPYQKTLGREIGKVTMTMLEEKGVTFYMNDAVAEV 345

  Fly   499 VRDETNLK-LELNNGMTLMSDVVVVCVGCTPNTDLAGPSRLEVDRSLGGFVVNAELEARRNL--- 559
            ......:| ::|.:|:|:.:|:::|.:|.:||::....||:.:|..  .:|:..|. .|.|:   
Zfish   346 QGKNRRVKAVKLKSGITIEADLLIVAIGVSPNSEFLKGSRVRMDSK--NYVIVDEY-MRTNITDV 407

  Fly   560 YVAGDASCFFDPL---LGRR-RVEHHDHSVVSGRLAGENMTGAKKPYQHQSMFWSDL-GPEIGYE 619
            |.|||.:.|  ||   .|:: .:.|...:...||:|..||...:........:|:.| |..|.|.
Zfish   408 YCAGDLTSF--PLKMAKGQKVSLGHWQIAQAHGRIAALNMLCREVELNTVPYYWTVLFGRTIRYA 470

  Fly   620 GIG 622
            |.|
Zfish   471 GYG 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 84/335 (25%)
Pyr_redox 427..512 CDD:278498 18/85 (21%)
AIF_C 591..720 CDD:291391 10/33 (30%)
aifm5XP_001920911.2 Rieske_AIFL_N 21..114 CDD:239560
Pyr_redox_2 140..438 CDD:285266 86/341 (25%)
Pyr_redox 279..360 CDD:278498 19/86 (22%)
Reductase_C 457..535 CDD:291425 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.