DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and sqor

DIOPT Version :10

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001017881.1 Gene:sqor / 550580 ZFINID:ZDB-GENE-050417-436 Length:445 Species:Danio rerio


Alignment Length:86 Identity:22/86 - (25%)
Similarity:31/86 - (36%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 RFKQWTGSERSLFFEPDEF-FIDPEDLDDNANGGIAVAQGFSVKKV---------------DAQK 365
            |.|:..|:|.....||.|. :..|......|......:.|.|...|               |.:|
Zfish    55 RLKRKVGAENVAIVEPSEMHYYQPIWTLVGAGAKSVASSGRSTSSVIPSGVTWVKSKVAEFDLEK 119

  Fly   366 RIVTLNDGYEISYDECLIATG 386
            ..|..:.|.:||||..::|.|
Zfish   120 NTVHTDCGKKISYDYLIVALG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 NirB 256..719 CDD:440863 22/86 (26%)
AIF_C 591..721 CDD:464279
sqorNP_001017881.1 FadH2 65..339 CDD:440215 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.